Gene Sspon.03G0027790-1B
Sequence ID | Sspon.03G0027790-1B add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 108aa | ||
Gene Ontology |
![]()
|
Length: 108 amino acids
>Sspon.03G0027790-1B_SACSP MKLMKRNCWNNAQVQVVVMSANMGCSHCRQRVANVVSKMNGLLDYMVDFGKKEVTVRGKV EHTKKKKKHRKTLLGAAGWDDDARSAAASSPGGGQARTLSWFLGCYGS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP471861 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Heavy-metal-associated, conserved site
IPR017969
|
Heavy-metal-associated, conserved site | Conserved_site |
Figure 1: IPR domains for Sspon.03G0027790-1B
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Sspon.03G0027790-2C | ultra-paralogy | 0.001 | 0 | - | - |
maize_pan_p010927 | orthology | 0.186 | 2 | - | - |
musac_pan_p022732 | orthology | 0.928 | 3 | - | - |
sorbi_pan_p018268 | orthology | 0.152 | 1 | 111 | 7.94e-33 |