Gene Sspon.03G0027790-2C
| Sequence ID | Sspon.03G0027790-2C add to my list |
|---|---|
| Species | Saccharum spontaneum |
| Alias | No gene alias |
| Length | 64aa |
Length: 64 amino acids
>Sspon.03G0027790-2C_SACSP MVDFGKKEVTVRGKVEHTKKKKKKHRKTLLGAAGWDDDARSAAASSPGGGQARTLSWFLG CYGS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP022701 | Unannotated cluster |
| 3 | GP047979 | Unannotated cluster |
| 4 | GP471861 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Sspon.03G0027790-1B | ultra-paralogy | 0.001 | 0 | - | - |
| maize_pan_p010927 | orthology | 0.186 | 2 | - | - |
| musac_pan_p022732 | orthology | 0.928 | 3 | - | - |
| sorbi_pan_p018268 | orthology | 0.152 | 1 | - | - |