Gene Sspon.04G0025740-1B
Sequence ID | Sspon.04G0025740-1B add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 111aa | ||
Gene Ontology |
![]()
|
Length: 111 amino acids
>Sspon.04G0025740-1B_SACSP MAAETVVLKVAMSCEGCAGAVRRVLSKMEGIETFDIDLKEQKVTVKGNVKPEDVFQTVSK SGKKTSYWEGQATAPDASAPAAAEAAPNTAAEAPADAAAAVPEITPAKADA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.04G0025740-1B
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba06_g17710.1 | orthology | 0.537 | 4 | - | - |
Sspon.04G0025740-2C | orthology | 0 | 1 | - | - |
Sspon.04G0025740-3D | orthology | 0 | 1 | - | - |
musac_pan_p007187 | orthology | 0.514 | 4 | - | - |
sorbi_pan_p000050 | orthology | 0.0293 | 2 | 174 | 4.89e-58 |