Gene Sspon.04G0025740-1B


Sequence ID Sspon.04G0025740-1B  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 111aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 111 amino acids

>Sspon.04G0025740-1B_SACSP
MAAETVVLKVAMSCEGCAGAVRRVLSKMEGIETFDIDLKEQKVTVKGNVKPEDVFQTVSK
SGKKTSYWEGQATAPDASAPAAAEAAPNTAAEAPADAAAAVPEITPAKADA





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Sspon.04G0025740-1B



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba06_g17710.1 orthology 0.537 4 - -
Sspon.04G0025740-2C orthology 0 1 - -
Sspon.04G0025740-3D orthology 0 1 - -
musac_pan_p007187 orthology 0.514 4 - -
sorbi_pan_p000050 orthology 0.0293 2 174 4.89e-58