Gene Sspon.05G0013620-1A
Sequence ID | Sspon.05G0013620-1A add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 155aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 155 amino acids
>Sspon.05G0013620-1A_SACSP MGIVDVVSEYCSLPRSRRHLKKRKQFQTVEMKVRIDCEGCERKVKKALEDMKGVSSVEVT AKQNKVTVTGYVDAAKVMRRVAYKTGKRVEPWPYVPYEMVAHPYAPGAYDKKAPAGYVRN VVADPTAAPLARASSTEARYTAAFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.05G0013620-1A
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba04_g22800.1 | orthology | 0.386 | 3 | - | - |
Mba04_g33020.1 | orthology | 0.426 | 3 | - | - |
musac_pan_p005239 | orthology | 0.426 | 3 | - | - |
musac_pan_p034720 | orthology | 0.427 | 3 | - | - |
sorbi_pan_p013767 | orthology | 0.0261 | 1 | - | - |