Gene Sspon.05G0023740-1P
Sequence ID | Sspon.05G0023740-1P add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 123aa | ||
Gene Ontology |
![]()
|
Length: 123 amino acids
>Sspon.05G0023740-1P_SACSP MADMQIVLAGRKIEAQYVEMKVPLYSYGCEKKIKKALSHLKGIHSVQVDYHQQKVTVWGI CNRDDVLAAVRKKRRDARFWNSDELGPGEHVPPPGEAPKQYLAAFTAYRLRKSWKKLFPL IRL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP342521 | Unannotated cluster |
4 | GP467872 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.05G0023740-1P
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba04_g24060.1 | orthology | 0.515 | 5 | - | - |
Sspon.05G0023740-2D | orthology | 0 | 1 | - | - |
XP_008808278.1 | orthology | 0.602 | 5 | - | - |
XP_010919018.1 | orthology | 0.609 | 6 | - | - |
XP_010934032.1 | orthology | 0.567 | 5 | - | - |
cocnu_pan_p020678 | orthology | 0.583 | 5 | - | - |
cocnu_pan_p024529 | orthology | 0.656 | 6 | - | - |
musac_pan_p009117 | orthology | 0.53 | 5 | - | - |
sorbi_pan_p001968 | orthology | 0.0183 | 2 | - | - |