Gene Sspon.06G0001840-3D
| Sequence ID | Sspon.06G0001840-3D add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 103aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 103 amino acids
>Sspon.06G0001840-3D_SACSP MAITILCAFPDCWRSQSTELKVEMVALHEKRVRKCLSKVKGIERVEVEASLQKVVVTGCV NRSKILKALRRVGLRAEPWSPHNELLSAYATSTLMFNNSYAFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.06G0001840-3D
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.777 | 9 | - | - |
| Ca_3_262.11 | orthology | 0.777 | 9 | - | - |
| Ca_455_136.3 | orthology | 0.777 | 9 | - | - |
| Ca_68_16.11 | orthology | 0.8 | 9 | 104.8 | 9.2e-23 |
| Cc10_g00290 | orthology | 0.8 | 9 | 95.5 | 1.9e-20 |
| Cg3g025710.1 | orthology | 0.671 | 11 | 109 | 1.7e-24 |
| Cm122260.1 | orthology | 0.683 | 10 | 110.5 | 1e-24 |
| Cs3g27690.1 | orthology | 0.671 | 11 | 109 | 1.9e-24 |
| DCAR_023025 | orthology | 0.661 | 6 | 102.1 | 2.5e-22 |
| MELO3C017056.2.1 | orthology | 0.817 | 11 | - | - |
| Manes.05G127500.1 | orthology | 0.71 | 9 | - | - |
| Manes.18G002200.1 | orthology | 0.723 | 9 | 106.7 | 1e-23 |
| Mba08_g25790.1 | orthology | 0.409 | 3 | 129.4 | 1.5e-30 |
| Oeu013567.1 | orthology | 0.681 | 7 | 101.3 | 5.9e-22 |
| Sspon.06G0001840-2C | ultra-paralogy | 0.011 | 0 | - | - |
| XP_010932092.1 | orthology | 0.35 | 4 | 131 | 7.8e-31 |
| XP_017697769.1 | orthology | 0.375 | 4 | 132.5 | 2.5e-31 |
| XP_019707878.1 | orthology | 0.388 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.826 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.824 | 7 | 104.4 | 5e-23 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.822 | 6 | - | - |
| capan_pan_p037558 | orthology | 0.788 | 8 | - | - |
| cicar_pan_p012771 | orthology | 0.944 | 8 | 104 | 7.54e-31 |
| cocnu_pan_p024788 | orthology | 0.35 | 4 | 128 | 2.13e-40 |
| cocnu_pan_p029661 | orthology | 0.413 | 5 | - | - |
| cucsa_pan_p017207 | orthology | 0.817 | 11 | - | - |
| maldo_pan_p020708 | orthology | 0.707 | 9 | 102 | 1.25e-29 |
| medtr_pan_p031498 | orthology | 0.877 | 8 | 102 | 4.33e-30 |
| musac_pan_p036492 | orthology | 0.397 | 3 | 129 | 1.78e-40 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.834 | 6 | - | - |
| sorbi_pan_p020199 | orthology | 0.0524 | 1 | - | - |
| soybn_pan_p018879 | orthology | 0.877 | 6 | 99.4 | 1.2e-28 |
| soybn_pan_p037728 | orthology | 0.902 | 7 | - | - |
| soybn_pan_p037999 | orthology | 0.943 | 7 | - | - |
| soybn_pan_p041984 | orthology | 0.912 | 7 | - | - |
| thecc_pan_p004256 | orthology | 0.719 | 10 | 99.4 | 6.45e-29 |
| vitvi_pan_p014910 | orthology | 0.633 | 8 | 103 | 2.14e-30 |
| vitvi_pan_p031077 | orthology | 0.633 | 8 | - | - |