Gene Sspon.08G0017140-2B
Sequence ID | Sspon.08G0017140-2B add to my list |
---|---|
Species | Saccharum spontaneum |
Alias | No gene alias |
Length | 89aa |
Length: 89 amino acids
>Sspon.08G0017140-2B_SACSP MELCFYVYHAKMTAGYIVGSLVGSFAIAYLCDTFVSDKKAFGGSTPKTVSEKEWWQATDA KFQAWPRTAGPPVVMNPISRQNFIVKSTE
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for Sspon.08G0017140-2B
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Sspon.08G0017140-1A | orthology | 0 | 1 | - | - |
sorbi_pan_p028841 | orthology | 0.0742 | 2 | - | - |