Gene XP_008786377.1
Sequence ID | XP_008786377.1 add to my list | ||
---|---|---|---|
Species | Phoenix dactylifera | ||
Alias | No gene alias | ||
Length | 242aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 242 amino acids
>XP_008786377.1_PHODC MVAGEKKELVVVEKEKREEVITAVYKLHLHCKDCARQVEKTIIRTQGIHKVDIEVETGKV SVKGVFDPVKIHKRIEKKTRKKVELISPKPKEKVDKPPEKKVEKKKEEVVKTTVIKVHMH CKNCEYDLQRKLLKLKGVHTVKMNRDAQTCTVVGTIEEKKLIEYIRKKANKHGEIVPQKI EKKVEKEEEKKKVEVKDGKEKVVVVKEKEEVKSKDIVVPYFVHCTHAPDWFSDENPNACS VM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008786377.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr15030 | orthology | 0.379 | 2 | 227.3 | 9.6e-60 |
Mba04_g18150.1 | orthology | 0.433 | 4 | 166.8 | 1.9e-41 |
XP_019709272.1 | orthology | 0.0556 | 2 | 304.7 | 9.2e-83 |
XP_026662278.1 | ultra-paralogy | 0.428 | 0 | - | - |
cocnu_pan_p033142 | orthology | 0.0679 | 2 | 332 | 1.34e-116 |
musac_pan_p040407 | orthology | 0.422 | 4 | 237 | 3.73e-79 |