GreenPhyl v5 - Gene XP

Gene XP_008798426.1

Sequence ID

XP_008798426.1 ^{add to my list}

Species

Phoenix dactylifera

Alias

No gene alias

Length

151aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

151 amino acids

>XP_008798426.1_PHODC
MGGTLEYFSGLLGSGHEKHKRKKQLQTVELKVRMDCEGCELKVKKALSSMKGVQSIDINR
KQQKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNLVTHPYTAGAYDKKAPPGYVRNVE
SVSVSSSQASKQDDQITNMFSDDNPNSCSIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463617	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for XP_008798426.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
Mba07_g10470.1	orthology	0.335	3	-	-
ORGLA03G0184300.1	orthology	0.535	4	-	-
Sspon.02G0033800-1B	orthology	0.442	3	-	-
Sspon.02G0033800-2C	orthology	0.461	3	-	-
bradi_pan_p025295	orthology	0.373	3	220	8.54e-75
bradi_pan_p042229	orthology	0.52	3	-	-
musac_pan_p025676	orthology	0.35	3	-	-
orysa_pan_p000534	orthology	0.541	4	-	-
sorbi_pan_p025511	orthology	0.43	3	-	-
tritu_pan_p031058	orthology	0.468	3	-	-