GreenPhyl v5 - Gene XP

Gene XP_008807137.1

Sequence ID

XP_008807137.1 ^{add to my list}

Species

Phoenix dactylifera

Alias

No gene alias

Length

155aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

155 amino acids

>XP_008807137.1_PHODC
MGILDHVSELCSIPKYNRKPKKRQQFQTVEMKMRIDCEGCERKAKKALKGMKGISTVEIE
PKLNKVTVTGYVDAKKVIQRLRWKTGKLVEPWPYVPYDVVAHPYAPGAYDKKAPPGYVRD
VLDDPKLAPLARASSMEERYSNAFSDENPSSCTIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463617	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for XP_008807137.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
ORGLA03G0040300.1	orthology	0.556	3	-	-
Sspon.01G0050820-1C	orthology	0.58	4	-	-
Sspon.01G0050820-2D	orthology	0.574	4	-	-
XP_010920102.1	orthology	0.19	2	247.7	8.5e-66
cocnu_pan_p019869	orthology	0.158	2	268	7.07e-94
maize_pan_p031380	orthology	0.601	4	-	-
orysa_pan_p027349	orthology	0.556	3	-	-
sorbi_pan_p009526	orthology	0.559	3	-	-