Gene XP_008808278.1


Sequence ID XP_008808278.1  add to my list
Species Phoenix dactylifera
Alias No gene alias
Length 125aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 125 amino acids

>XP_008808278.1_PHODC
MAGLQIVPAGKHVEAQYVEMKVPLYSYGCEKKIKKALSHMRGIHSVHVDYHLQKVTVWGI
CNKDDVLATIRKKRREARFWDQIEAEVKSNVAEEETDAEIAPHPATVNMHKCRKSWKKLF
PLVLY




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_008808278.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.822 6 146.7 1.1e-35
Mba04_g24060.1 orthology 0.41 3 188.3 3.2e-48
Sspon.05G0023740-1B orthology 0.602 4 - -
Sspon.05G0023740-1P orthology 0.602 5 - -
Sspon.05G0023740-2D orthology 0.602 5 159.8 3.4e-39
XP_010919018.1 orthology 0.106 2 229.2 2.5e-60
bradi_pan_p042306 orthology 0.85 5 150 7.47e-48
cocnu_pan_p024529 orthology 0.154 2 226 3.8e-78
maize_pan_p011588 orthology 0.688 3 150 3.03e-48
musac_pan_p009117 orthology 0.426 3 185 6.61e-62
orysa_pan_p048607 orthology 0.78 4 151 1.51e-48
orysa_pan_p051674 orthology 1 4 - -
sorbi_pan_p001968 orthology 0.618 4 162 6.14e-53
tritu_pan_p012747 orthology 0.823 6 - -
tritu_pan_p017403 orthology 0.832 6 146 1.67e-46
tritu_pan_p047012 orthology 0.814 6 - -