Gene XP_008811964.1
Sequence ID | XP_008811964.1 add to my list | ||
---|---|---|---|
Species | Phoenix dactylifera | ||
Alias | No gene alias | ||
Length | 150aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 150 amino acids
>XP_008811964.1_PHODC MGALDYLSNFCSVTETRRSLRKKRKPLQTVELKVKMDCDGCERRVKHAVTSLKGVTMVDV NRKQSRVTVTGHVEPKKVLNKVKSTGKRVEFWPYVPYNLVYYPYAAQAYDKRAPSGFVRN VDQAVPSPGAPEEQFTSLFSDDNPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008811964.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr15258 | orthology | 0.318 | 2 | 245 | 2.8e-65 |
Mba01_g16120.1 | orthology | 0.367 | 4 | 240.7 | 6.4e-64 |
Mba02_g09520.1 | orthology | 0.335 | 4 | - | - |
XP_010916340.1 | orthology | 0.0302 | 2 | 297.4 | 9.1e-81 |
cocnu_pan_p017926 | orthology | 0.0505 | 2 | 291 | 2.43e-103 |
musac_pan_p009592 | orthology | 0.355 | 4 | - | - |
musac_pan_p028185 | orthology | 0.315 | 4 | 246 | 2.75e-85 |