Gene XP_008813766.1


Sequence ID XP_008813766.1  add to my list
Species Phoenix dactylifera
Alias No gene alias
Length 149aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 149 amino acids

>XP_008813766.1_PHODC
MTIIEMCVHMDCSGCESKIRKALQKLEGVDNVDVDMGRQKVTVTGWVDQKKVLKAVRKTG
RRAVLWPYPYGAENHTFTVQQYYNQHHPALATAPVSATAAPSSSYNYYKHGYDDSRMHGY
YQPSAHSAVVSGRAGDIFSVENPNNCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_008813766.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU3Hr1G072940.2 orthology 0.639 5 155.6 2.8e-38
Mba03_g16740.1 orthology 0.227 4 - -
ORGLA01G0256400.1 orthology 0.547 4 188.3 3.6e-48
Sspon.03G0031090-1B orthology 0.61 4 - -
Sspon.03G0031090-2C orthology 0.61 4 158.3 1.2e-38
XP_010920018.1 orthology 0.0743 2 290 1.4e-78
bradi_pan_p002062 orthology 0.68 4 152 2.82e-48
cocnu_pan_p020915 orthology 0.0826 2 216 5.38e-74
musac_pan_p001588 orthology 0.247 4 221 1.57e-75
orysa_pan_p003551 orthology 0.54 4 191 3.64e-63
sorbi_pan_p007128 orthology 0.609 4 174 9.68e-57
tritu_pan_p029517 orthology 0.594 5 167 5.82e-54