Gene XP_010912255.1
| Sequence ID | XP_010912255.1 add to my list | ||
|---|---|---|---|
| Species | Elaeis guineensis | ||
| Alias | No gene alias | ||
| Length | 129aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 129 amino acids
>XP_010912255.1_ELAGV MLRSAPSNLYLNTPAGLRRPSESVGRLIYAMAETVVLRVGMSCQGCVGAVKRVLGKMEGV ESFDVDLKEQKVTVKGNVTPDAVLQTVSKTGKKTSFWEAEPETKETAPAAAAAASTAPAA AAAASTAAA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP239638 | Unannotated cluster |
| 3 | GP341755 | Unannotated cluster |
| 4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010912255.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_010912254.1 | ultra-paralogy | 0.0011 | 0 | - | - |
| XP_019702685.1 | ultra-paralogy | 0.0089 | 0 | - | - |
| XP_019702688.1 | ultra-paralogy | 0.0089 | 0 | - | - |