GreenPhyl v5 - Gene XP

Gene XP_010915521.1

Sequence ID

XP_010915521.1 ^{add to my list}

Species

Elaeis guineensis

Alias

No gene alias

Length

146aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

146 amino acids

>XP_010915521.1_ELAGV
MTIVEMCVHMDCSGCESKIRKALLKLKGVDDVDIDMVQQKVTVTGYVDQKKVLKAVRKTG
RRAVLWPYPYNVEYRTYSQEYYHQHHPNPAYHLIFNSNPHSYNYYRHGYNDSDMHGYYQK
PTSSHIVDERARSIFSDDNPNACSIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP078604	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for XP_010915521.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
Mba06_g14980.1	orthology	0.623	4	-	-
Mba07_g12280.1	orthology	0.321	4	-	-
Mba10_g22190.1	orthology	0.363	4	231.9	2.9e-61
XP_008812071.1	orthology	0.0662	2	282.7	2.1e-76
cocnu_pan_p023665	orthology	0.0396	1	290	1.04e-102
musac_pan_p012257	orthology	0.369	4	-	-
musac_pan_p013615	orthology	0.513	4	-	-
musac_pan_p015597	orthology	0.326	4	231	2.55e-79