Gene XP_010919018.1
Sequence ID | XP_010919018.1 add to my list | ||
---|---|---|---|
Species | Elaeis guineensis | ||
Alias | No gene alias | ||
Length | 125aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 125 amino acids
>XP_010919018.1_ELAGV MAGLQIVPADKRVEAQYVEMKVPLYSYGCEKKIKKALSHMRGIHSVHVDYHLQKVTVWGI CNQDDVLATIRKKRREARFWDQMETEVKNKVAEEEADAGNAPDPATVNTHKFRKSWKKLF PLVLY
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP342521 | Unannotated cluster |
4 | GP077751 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010919018.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU2Hr1G093870.1 | orthology | 0.829 | 7 | 149.4 | 1.7e-36 |
Mba04_g24060.1 | orthology | 0.417 | 4 | - | - |
Sspon.05G0023740-1B | orthology | 0.609 | 5 | - | - |
Sspon.05G0023740-1P | orthology | 0.609 | 6 | - | - |
Sspon.05G0023740-2D | orthology | 0.609 | 6 | 161.8 | 8.9e-40 |
XP_008808278.1 | orthology | 0.106 | 2 | 228.8 | 3.1e-60 |
bradi_pan_p042306 | orthology | 0.857 | 6 | - | - |
cocnu_pan_p024529 | orthology | 0.116 | 1 | 231 | 7.99e-80 |
maize_pan_p011588 | orthology | 0.695 | 4 | 149 | 1.75e-47 |
musac_pan_p009117 | orthology | 0.433 | 4 | - | - |
orysa_pan_p048607 | orthology | 0.787 | 5 | - | - |
orysa_pan_p051674 | orthology | 1 | 5 | - | - |
sorbi_pan_p001968 | orthology | 0.625 | 5 | 161 | 1.24e-52 |
tritu_pan_p012747 | orthology | 0.83 | 7 | - | - |
tritu_pan_p017403 | orthology | 0.839 | 7 | - | - |
tritu_pan_p047012 | orthology | 0.822 | 7 | - | - |