Gene XP_010920018.1


Sequence ID XP_010920018.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 149aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 149 amino acids

>XP_010920018.1_ELAGV
MTIVEMCVHMDCSGCESKIRKALQKLKGVDNVDIDMGRQKVTVTGWVDQKKVLKAVRKTG
RRAVLWPYPYGAENHTFTIQQYYHQQHPALATGPVSVTAAPSSSYNYYKHGYDDSRMHGS
YHPSAHSAVVNERAGDIFSVENPNNCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_010920018.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU3Hr1G072940.2 orthology 0.651 6 153.7 1.1e-37
Mba03_g16740.1 orthology 0.239 5 - -
ORGLA01G0256400.1 orthology 0.56 5 188 4.7e-48
Sspon.03G0031090-1B orthology 0.623 5 - -
Sspon.03G0031090-2C orthology 0.623 5 158.3 1.2e-38
XP_008813766.1 orthology 0.0743 2 290.4 1e-78
bradi_pan_p002062 orthology 0.692 5 150 2.3e-47
cocnu_pan_p020915 orthology 0.0363 1 226 5.85e-78
musac_pan_p001588 orthology 0.26 5 213 2.49e-72
orysa_pan_p003551 orthology 0.553 5 189 1.04e-62
sorbi_pan_p007128 orthology 0.622 5 174 9.68e-57
tritu_pan_p029517 orthology 0.607 6 163 1.93e-52