Gene XP_010926254.1


Sequence ID XP_010926254.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 150aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 150 amino acids

>XP_010926254.1_ELAGV
MGGTLEYFSGLLGSGHKHRKKQQLQTVELKVRMDCEGCELKVKKALSSMKGVQSVNINRK
QQKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNSVTHPYTAGTYDKKAPPGYVRSVEA
GTVSSIQASKQDDQMINMFSDDNPNSCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_010926254.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba07_g10470.1 orthology 0.4 4 - -
ORGLA03G0184300.1 orthology 0.599 5 - -
Sspon.02G0033800-1B orthology 0.506 4 - -
Sspon.02G0033800-2C orthology 0.525 4 - -
bradi_pan_p025295 orthology 0.437 4 - -
bradi_pan_p042229 orthology 0.585 4 - -
cocnu_pan_p024481 orthology 0.0766 1 278 7.51e-98
musac_pan_p025676 orthology 0.415 4 - -
orysa_pan_p000534 orthology 0.605 5 - -
sorbi_pan_p025511 orthology 0.495 4 204 1.73e-68
tritu_pan_p031058 orthology 0.532 4 - -