Gene XP_010934033.1


Sequence ID XP_010934033.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 148aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 148 amino acids

>XP_010934033.1_ELAGV
MFRFQRQRTSLSNAMSIVELNVHMDCEGCEKRIRKAISKLDGVDTVEIDMDKQKVTVTGY
VDQRKVLKAVRRTGRKAEFWPYPYDSQYYPFAIQYLEDSTYSSTYNYYRHGYNSSVCGYF
PDPAYSMIVDDEMAAVFNDDNVHACMIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_010934033.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr00501 orthology 0.208 3 258.1 3.1e-69
HORVU6Hr1G066220.1 orthology 0.72 6 161.4 5.1e-40
Mba02_g11510.1 orthology 0.263 5 189.9 1.3e-48
Sspon.04G0006170-1A orthology 0.87 6 - -
Sspon.04G0023540-1B orthology 0.965 6 157.5 2e-38
XP_008783549.1 orthology 0.06 1 289.3 2.3e-78
cocnu_pan_p034578 orthology 0.0796 2 242 4.52e-84
maize_pan_p014734 orthology 0.855 6 145 8.01e-46
musac_pan_p001552 orthology 0.213 5 258 6.12e-90
orysa_pan_p046445 orthology 0.503 5 214 1.98e-72
sorbi_pan_p005993 orthology 0.577 5 200 6.84e-67
tritu_pan_p005371 orthology 0.516 6 - -
tritu_pan_p026136 orthology 0.521 6 205 5.51e-69