Gene XP_017697769.1
| Sequence ID | XP_017697769.1 add to my list | ||
|---|---|---|---|
| Species | Phoenix dactylifera | ||
| Alias | No gene alias | ||
| Length | 88aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 88 amino acids
>XP_017697769.1_PHODC METIELKVEMVALHEKRVRKCLSKVKGIEKVEVEASIQKVVVTGYAHRNKILKALRRVGL RAEFWSPQNEILSAYASASLMINNFSFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_017697769.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.482 | 8 | - | - |
| Ca_3_262.11 | orthology | 0.482 | 8 | - | - |
| Ca_455_136.3 | orthology | 0.482 | 8 | - | - |
| Ca_68_16.11 | orthology | 0.505 | 8 | 117.9 | 8.9e-27 |
| Cc10_g00290 | orthology | 0.505 | 8 | 104 | 4.5e-23 |
| Cg3g025710.1 | orthology | 0.376 | 10 | 132.5 | 1.2e-31 |
| Cm122260.1 | orthology | 0.387 | 9 | 129.4 | 1.8e-30 |
| Cs3g27690.1 | orthology | 0.376 | 10 | 132.5 | 1.3e-31 |
| DCAR_023025 | orthology | 0.365 | 5 | 123.6 | 6.8e-29 |
| HORVU7Hr1G051110.3 | orthology | 0.625 | 6 | 99.4 | 1.4e-21 |
| MELO3C017056.2.1 | orthology | 0.521 | 10 | 117.5 | 3.7e-27 |
| Manes.05G127500.1 | orthology | 0.414 | 8 | - | - |
| Manes.18G002200.1 | orthology | 0.427 | 8 | 121.7 | 2.6e-28 |
| Mba08_g25790.1 | orthology | 0.248 | 4 | 140.2 | 7e-34 |
| ORGLA08G0178600.1 | orthology | 0.345 | 5 | 130.6 | 5.3e-31 |
| Oeu013567.1 | orthology | 0.386 | 6 | 118.6 | 3e-27 |
| Sspon.06G0001840-1A | orthology | 0.553 | 4 | - | - |
| Sspon.06G0001840-2C | orthology | 0.365 | 4 | - | - |
| Sspon.06G0001840-3D | orthology | 0.375 | 4 | 129.8 | 2.6e-30 |
| XP_019707878.1 | orthology | 0.0635 | 2 | - | - |
| bradi_pan_p007471 | orthology | 0.356 | 5 | 134 | 1.52e-42 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.531 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.529 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.527 | 5 | 124 | 5.2e-29 |
| capan_pan_p037558 | orthology | 0.492 | 7 | 106 | 5.31e-32 |
| cicar_pan_p012771 | orthology | 0.649 | 7 | 123 | 1.4e-38 |
| cocnu_pan_p029661 | orthology | 0.0894 | 2 | - | - |
| cucsa_pan_p017207 | orthology | 0.521 | 10 | 116 | 4.88e-36 |
| maize_pan_p023740 | orthology | 0.347 | 4 | 126 | 1.23e-39 |
| maldo_pan_p020708 | orthology | 0.411 | 8 | 124 | 9.83e-39 |
| medtr_pan_p031498 | orthology | 0.581 | 7 | 125 | 3.38e-39 |
| musac_pan_p036492 | orthology | 0.236 | 4 | 140 | 1.75e-45 |
| orysa_pan_p046260 | orthology | 0.321 | 5 | 132 | 5.57e-42 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.538 | 5 | 123.6 | 6.1e-29 |
| sorbi_pan_p020199 | orthology | 0.323 | 4 | 131 | 7.41e-42 |
| soybn_pan_p018879 | orthology | 0.581 | 5 | 120 | 2.71e-37 |
| soybn_pan_p037728 | orthology | 0.606 | 6 | - | - |
| soybn_pan_p037999 | orthology | 0.647 | 6 | - | - |
| soybn_pan_p041984 | orthology | 0.616 | 6 | - | - |
| thecc_pan_p004256 | orthology | 0.424 | 9 | 111 | 4.63e-34 |
| tritu_pan_p008810 | orthology | 0.361 | 6 | 127 | 4.39e-40 |
| vitvi_pan_p014910 | orthology | 0.338 | 7 | 130 | 2.48e-41 |
| vitvi_pan_p031077 | orthology | 0.338 | 7 | - | - |