Gene XP_017700247.1


Sequence ID XP_017700247.1  add to my list
Species Phoenix dactylifera
Alias No gene alias
Length 106aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 106 amino acids

>XP_017700247.1_PHODC
MGSLFKHLNLPNAKNCFMSNKFYCMTMRINIDCNGCYRKIRRALLQMHELESHLIEKKQC
RVSVCGEFIPQDVAIRLRKKTNRRVEILEIKEVDMNPESNTVQKPP




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for XP_017700247.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba09_g23440.1 orthology 0.391 3 124.4 4.8e-29
XP_010909619.1 orthology 0.119 2 190.7 8.5e-49
cocnu_pan_p015513 orthology 0.129 2 192 2.87e-65
musac_pan_p014766 orthology 0.366 3 140 3.74e-45