Gene XP_019702685.1
Sequence ID | XP_019702685.1 add to my list | ||
---|---|---|---|
Species | Elaeis guineensis | ||
Alias | No gene alias | ||
Length | 132aa | ||
Gene Ontology |
![]()
|
Length: 132 amino acids
>XP_019702685.1_ELAGV MLRSAPSNLYLNTPAGLRRPSESVGRLIYAMAEVFFCDPPSFCPSGTVVLRVGMSCQGCV GAVKRVLGKMEGVESFDVDLKEQKVTVKGNVTPDAVLQTVSKTGKKTSFWEAEPETKETA PAAAAAASTAAA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_019702685.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
XP_010912254.1 | ultra-paralogy | 0.0089 | 0 | - | - |
XP_010912255.1 | ultra-paralogy | 0.0089 | 0 | - | - |
XP_019702688.1 | ultra-paralogy | 0.0011 | 0 | - | - |