Gene XP_019709212.1
Sequence ID | XP_019709212.1 add to my list | ||
---|---|---|---|
Species | Elaeis guineensis | ||
Alias | No gene alias | ||
Length | 281aa | ||
Gene Ontology |
![]()
|
Length: 281 amino acids
>XP_019709212.1_ELAGV MGLEICFQSARTRVVRQSRRLLSTEMRSDMMPSKRPAWVRMGSSDSLRRVMSMIRQVVGF DTEAGHSDGDEDGKREEERGMRERKRGSGLGFNLYIRARIREAIIFFLSTIXLPFRYQGN NYSSSSNTYCYFDKIYINKKNMAKGRPLSLQTVELKVRMCCTGCERVVKNALLKLRGIDS VEVDLEMEKVTVTGYIDRNKVLKEVRRSGKKAEFWPNPDLPLYFTSAANYFRDEESFRDT YNYWRHGYNGDNHGHVPVPRRGDDRVSNLFNDDDVNACHVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_019709212.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba11_g02440.1 | orthology | 0.441 | 4 | - | - |
Mba11_g19060.1 | orthology | 0.347 | 4 | - | - |
XP_008783756.1 | orthology | 0.288 | 2 | - | - |
cocnu_pan_p018453 | orthology | 0.0205 | 1 | - | - |
musac_pan_p008518 | orthology | 0.358 | 4 | - | - |
musac_pan_p022014 | orthology | 0.361 | 4 | - | - |