Gene XP_019709272.1


Sequence ID XP_019709272.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 241aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 241 amino acids

>XP_019709272.1_ELAGV
MVAGEKKEVVVEKETREEVITAVYKLHLHCKDCARHVEKTIIRTQGIHKVDIEVETGKVS
VKGVFDPVKIHKRIEKKTKKKVELISPKPKEKVDKPPEKKEEKKKEEVVKTTVIKVHMHC
KNCEYDLETILLKLKGVHTVKMNRDAQTCTVVGTIEEKKLIEYIRKKAHKRAEIVPQKIE
KKVEKEEEKKKVEVKDGKEKVEVVKEKEEVKSKEIVVPYFIHCTHAPDWLSDENPNACSV
M




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP502453 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_019709272.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr15030 orthology 0.389 3 237.7 7.1e-63
Mba04_g18150.1 orthology 0.445 5 193.7 1.5e-49
XP_008786377.1 orthology 0.0556 2 300.4 1.6e-81
XP_026662278.1 orthology 0.482 2 - -
cocnu_pan_p033142 orthology 0.0382 1 369 3.11e-131
musac_pan_p040407 orthology 0.433 5 251 1.24e-84