Gene XP_026655884.1
Sequence ID | XP_026655884.1 add to my list |
---|---|
Species | Phoenix dactylifera |
Alias | No gene alias |
Length | 80aa |
Length: 80 amino acids
>XP_026655884.1_PHODC LNMATKNIAAVATAFAIAYVSDTLITEKKIFGCTTPKTTSNKEWWEATDKQFQAWPRTAG PPVVMNPIRRQNFIVKSSES
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for XP_026655884.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
XP_010942716.1 | orthology | 0.188 | 1 | 130.2 | 1e-30 |