Gene brana_pan_p007268
| Sequence ID | brana_pan_p007268 add to my list |
|---|---|
| Species | Brassica napus |
| Alias | No gene alias |
| Pangenome status | Core (3/3) |
| Length | 82aa |
Length: 82 amino acids
>brana_pan_p007268_BRANA MGYIEPKKVLEAAKSTRKKVELWPYVPYTMVANPYISQAYDKKAPPNMVRKVLDTASVNE TTIDDSYSIIFSDENPNSCSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
BRANA_v5.0
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
| 1. | 2. | 3. | 4. | 5. | 6. | |
|---|---|---|---|---|---|---|
| 1. BnaA09g28180.1D2 | 0.00 | 5.01 | 1.23 | 5.01 | -0.00 | 5.01 |
| 2. BnaC09g27800.1D2 | 5.01 | 0.00 | 5.01 | -0.00 | 5.01 | -0.00 |
| 3. BnaA02g27910.1T | 1.23 | 5.01 | 0.00 | 5.01 | 1.23 | 5.01 |
| 4. BnaC09g25700.1T | 5.01 | -0.00 | 5.01 | 0.00 | 5.01 | -0.00 |
| 5. GSBRNA2T00060078001 | -0.00 | 5.01 | 1.23 | 5.01 | 0.00 | 4.89 |
| 6. GSBRNA2T00118921001 | 5.01 | -0.00 | 5.01 | -0.00 | 4.89 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G08570.1 | orthology | 0.133 | 2 | - | - |
| Cg3g015470.1 | orthology | 0.448 | 7 | - | - |
| Cm020980.1 | orthology | 0.438 | 6 | - | - |
| Cs3g18690.1 | orthology | 0.448 | 7 | - | - |
| Manes.18G070700.1 | orthology | 0.363 | 4 | - | - |
| braol_pan_p017356 | orthology | 0.0011 | 1 | 167 | 8.71e-56 |
| thecc_pan_p011528 | orthology | 0.403 | 5 | - | - |