Gene brana_pan_p014674
Sequence ID | brana_pan_p014674 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 102aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 102 amino acids
>brana_pan_p014674_BRANA MINYCVKTVEVNRKQSRLTVNGHVDPNKVLKRVKSTGKKAEFWPYIPQHMVYYPFAPGMY DKRAPAGHIRNPTQAFPAANAPGENYISLFSDDNVHAACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p014674
Represented sequence(s):
Unrepresented genome(s):
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
BRANA_v5.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
brana_pan_p038693 | ultra-paralogy | 0.0509 | 0 | - | - |
braol_pan_p032933 | orthology | 0.0519 | 2 | - | - |
brarr_pan_p002405 | orthology | 0.0585 | 2 | - | - |