Gene brana_pan_p022238
Sequence ID | brana_pan_p022238 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 275aa | ||
Gene Ontology |
![]()
|
Length: 275 amino acids
>brana_pan_p022238_BRANA MGEEVKPEEKEAVSAPEAVPEPASAEDEKKDVAEEKQAATEEENPTVEEEPQPPPPPPPF ILYVDLHCVGCAKKIQRSILKIRGVEEVVIDMNENQVTVKGVLDPQAVCNKIKKKTKRMA KVLSPLPAAEGEPLPPVITSQVSGLTTVELSVNMHCQACADQLKKKILKMRGVQTTVTEH TNGKVIVTGTMDEEKLVDYVYRRTKKQARIVPQPDPEAEKPEVEEEKKEETGEGGEEPAE TGEEKEAGDEKEDGGEEMEASEEMRVWEEEGMKRM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p022238
Represented sequence(s):
BRANA_Tapidor_v6.3
BRANA_v5.0
BRANA_Darmor_v8.1
1. | 2. | 3. | 4. | 5. | 6. | 7. | |
---|---|---|---|---|---|---|---|
1. BnaA06g25710.1D2 | 0.00 | 6.61 | 6.61 | 1.56 | 14.03 | 8.68 | -0.00 |
2. BnaA06g30440.1D2 | 6.61 | 0.00 | 1.06 | 4.48 | 0.86 | -0.00 | 3.61 |
3. BnaC07g33200.1D2 | 6.61 | 1.06 | 0.00 | 5.14 | 0.86 | 1.06 | 3.61 |
4. BnaA06g27950.1T | 1.56 | 4.48 | 5.14 | 0.00 | 8.31 | 7.03 | -0.00 |
5. BnaC07g29960.1T | 14.03 | 0.86 | 0.86 | 8.31 | 0.00 | 0.86 | 10.29 |
6. GSBRNA2T00147546001 | 8.68 | -0.00 | 1.06 | 7.03 | 0.86 | 0.00 | 7.14 |
7. GSBRNA2T00023382001 | -0.00 | 3.61 | 3.61 | -0.00 | 10.29 | 7.14 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G24580.1 | orthology | 0.135 | 3 | - | - |
braol_pan_p022609 | orthology | 0.0212 | 2 | 357 | 1.12e-124 |
brarr_pan_p028152 | orthology | 0.0133 | 1 | 358 | 3.5e-125 |