Gene brana_pan_p026835
Sequence ID | brana_pan_p026835 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 175aa | ||
Gene Ontology |
![]()
|
Length: 175 amino acids
>brana_pan_p026835_BRANA MSQPLMYYQYMQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGKVEPE AVFQTVSKTGKKTSYWPVEAEAEANAEAEPKVETETKPEAETKTEGKVVEVLGAKVDATK VEPEADVEPKLAETETKTEGKADDEVLDAKVDPKVDAKADVEQKLVEAETKPPQV
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p026835
Represented sequence(s):
BRANA_v5.0
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
1. | 2. | 3. | 4. | 5. | |
---|---|---|---|---|---|
1. BnaC04g30610.1D2 | 0.00 | 8.20 | 0.57 | 8.20 | -0.00 |
2. BnaA04g03680.1D2 | 8.20 | 0.00 | 7.43 | -0.00 | 8.20 |
3. BnaA08g23740.1T | 0.57 | 7.43 | 0.00 | 7.43 | 0.59 |
4. BnaA06g40110.1T | 8.20 | -0.00 | 7.43 | 0.00 | 8.20 |
5. GSBRNA2T00076402001 | -0.00 | 8.20 | 0.59 | 8.20 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56240.1 | orthology | 0.236 | 2 | - | - |
braol_pan_p031860 | orthology | 0.0064 | 1 | 190 | 1.95e-62 |