Gene brana_pan_p030902
Sequence ID | brana_pan_p030902 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 121aa | ||
Gene Ontology |
![]()
|
Length: 121 amino acids
>brana_pan_p030902_BRANA MDCEGCERRVRKSVQGMKGVTNVTVDPKQSKLTVEGFVQPNKVVRRVMHRTGKKAELWPY VPYEVVPHPYAPGAYDKKAPPGYVRNALADPLVAPLARASSFEVKYTSAFSDDNPNACTI M
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p030902
Represented sequence(s):
BRANA_v5.0
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
1. | 2. | 3. | 4. | 5. | |
---|---|---|---|---|---|
1. BnaA06g29350.1D2 | 0.00 | 0.83 | -0.00 | 0.83 | -0.00 |
2. BnaC03g48140.1D2 | 0.83 | 0.00 | 0.83 | -0.00 | 0.83 |
3. BnaC03g43190.1T | -0.00 | 0.83 | 0.00 | 0.83 | -0.00 |
4. GSBRNA2T00125048001 | 0.83 | -0.00 | 0.83 | 0.00 | 0.69 |
5. GSBRNA2T00147406001 | -0.00 | 0.83 | -0.00 | 0.69 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G66110.1 | orthology | 0.0467 | 3 | 242 | 2.72e-84 |
Cg1g001350.1 | orthology | 0.449 | 10 | 203 | 9.61e-69 |
Cm173610.1 | orthology | 0.443 | 9 | - | - |
Cm280940.1 | orthology | 0.443 | 9 | 211 | 7.19e-72 |
Cs1g25820.1 | orthology | 0.442 | 10 | 208 | 1.09e-70 |
MELO3C007926.2.1 | orthology | 0.331 | 5 | 204 | 3.03e-69 |
Manes.01G148900.1 | orthology | 0.391 | 5 | 196 | 5.05e-66 |
braol_pan_p039277 | orthology | 0.0092 | 2 | 248 | 5.18e-87 |
brarr_pan_p021369 | orthology | 0 | 1 | 251 | 5.6e-88 |
cucsa_pan_p018650 | orthology | 0.331 | 5 | 203 | 8.16e-69 |
maldo_pan_p003753 | orthology | 0.384 | 7 | 206 | 2.94e-70 |
medtr_pan_p005386 | orthology | 0.526 | 9 | 204 | 2.93e-69 |
thecc_pan_p011891 | orthology | 0.455 | 9 | 202 | 1.81e-68 |