Gene brana_pan_p038693
Sequence ID | brana_pan_p038693 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 116aa | ||
Gene Ontology |
![]()
|
Length: 116 amino acids
>brana_pan_p038693_BRANA MDCDGCERRLRNVVRRMKGVKTVEVNRKQSRLTVNGHVDPNKVLKRVKSTGKKAEFWPYI PQHMVYYPFAPGMYDKRAPAGHIRNPTQAFPAANAPGENYVSLFSDDNVHAACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p038693
Represented sequence(s):
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
BRANA_v5.0
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. BnaA10g19400.1D2 | 0.00 | -0.00 | -0.00 | 0.87 |
2. BnaA10g25120.1T | -0.00 | 0.00 | -0.00 | 0.87 |
3. GSBRNA2T00065867001 | -0.00 | -0.00 | 0.00 | 1.35 |
4. GSBRNA2T00094833001 | 0.87 | 0.87 | 1.35 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
brana_pan_p014674 | ultra-paralogy | 0.0509 | 0 | - | - |
braol_pan_p032933 | orthology | 0.0021 | 2 | - | - |
brarr_pan_p002405 | orthology | 0.0087 | 2 | - | - |