Gene brana_pan_p040071
Sequence ID | brana_pan_p040071 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 240aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 240 amino acids
>brana_pan_p040071_BRANA MEKSRMPRNVYEPLKTYFLKVNINCHGCNRKVKKTLRKVEGVYSVDIDTDQQAVIVRGNL DPEILVKKLNRRGKYAELLFKSPFHKDQFGNHHDNRSLRNAPYNFGNNHFNNVPSYERQS DGEMMKMMMANNMKPVMMNDADYFQMNDSSEDFQELFGETAQRHNYDEEVHPNLMRDMEL GYSNAYPAAETMNMHIPGRSNNMMMNERSFHSQMMNGPSLVPQFMNQEQFSARQLNGFYY
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p040071
Represented sequence(s):
BRANA_v5.0
BRANA_Tapidor_v6.3
BRANA_Darmor_v8.1
1. | 2. | 3. | 4. | 5. | |
---|---|---|---|---|---|
1. BnaC04g36600.1D2 | 0.00 | -0.00 | 4.37 | -0.00 | 3.89 |
2. BnaC04g36930.1T | -0.00 | 0.00 | 4.37 | -0.00 | 3.89 |
3. BnaA04g07480.1T | 4.37 | 4.37 | 0.00 | 4.37 | -0.00 |
4. GSBRNA2T00112783001 | -0.00 | -0.00 | 4.37 | 0.00 | 3.89 |
5. GSBRNA2T00114474001 | 3.89 | 3.89 | -0.00 | 3.89 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G37860.1 | orthology | 0.148 | 3 | 336 | 1.13e-117 |
AUR62023201-RA | orthology | 1 | 5 | - | - |
Bv2_027590_uyzx.t1 | orthology | 1 | 5 | - | - |
braol_pan_p024136 | orthology | 0.0102 | 2 | 482 | 1.19e-175 |
brarr_pan_p011412 | orthology | 0.0228 | 1 | 459 | 9.09e-167 |