Gene brana_pan_p044045
| Sequence ID | brana_pan_p044045 add to my list |
|---|---|
| Species | Brassica napus |
| Alias | No gene alias |
| Pangenome status | Core (3/3) |
| Length | 104aa |
Length: 104 amino acids
>brana_pan_p044045_BRANA MMDTENQKVAVSGSFDLEKLLKKLKKVTGGKGVEVVKEEEKDPEPEIVEVVKEKDEETEV VQEVKTEENARPEMVFEPNSDEQKEKEKYMLFSDENPNAKCTIS
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP243165 | Unannotated cluster |
| 3 | GP349495 | Unannotated cluster |
| 4 | GP474238 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
BRANA_Tapidor_v6.3
BRANA_v5.0
BRANA_Darmor_v8.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G15562.1 | orthology | 1 | 2 | - | - |
| braol_pan_p039287 | orthology | 0.0182 | 1 | 175 | 8.72e-58 |