Gene brana_pan_p048220
| Sequence ID | brana_pan_p048220 add to my list | ||
|---|---|---|---|
| Species | Brassica napus | ||
| Alias | No gene alias | ||
| Pangenome status | Specific (1/3) | ||
| Length | 284aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 284 amino acids
>brana_pan_p048220_BRANA MCPFFVIFAYIYYANLLIIFSGLKNKQNGEADNKSKNQKNGDSNKSDTKNQKNGDADKSN KKNQCKEIVLKVYMHCEGCASQVSHCLRGYDGVEQIKTEVGENKVVVSGKFDDPVKILRR VQKKFSKNAELISPKPNLNQDQKKEQQQKKESTPQIKTAILKMNIHCEGCVNEIKRGIEK IKGIQTAEPDRSKSMVVVRGVMDPPKLVEEIKKKLKRHAELVSQNTEKGKGNNDKESNNN NKGNKKNEDSDGNTIFSYPPQYSAQHNYPSQIFSEENVHSCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p048220
Represented sequence(s):
Unrepresented genome(s):
BRANA_v5.0
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. GSBRNA2T00041362001 | 0.00 | 2.14 | 2.14 | 2.14 |
| 2. GSBRNA2T00041363001 | 2.14 | 0.00 | -0.00 | -0.00 |
| 3. GSBRNA2T00041364001 | 2.14 | -0.00 | 0.00 | -0.00 |
| 4. GSBRNA2T00041365001 | 2.14 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G02960.1 | orthology | 0.169 | 2 | 357 | 1.52e-125 |
| Cg7g016680.1 | orthology | 1 | 7 | 184 | 3.14e-58 |
| Cm174370.1 | orthology | 1 | 6 | 186 | 9.3e-59 |
| Cs7g11080.1 | orthology | 1 | 7 | 197 | 5.58e-63 |
| Manes.13G008700.1 | orthology | 0.983 | 5 | 202 | 5.24e-65 |
| braol_pan_p002896 | orthology | 0.0201 | 1 | 428 | 3.45e-153 |
| orange1.1t05450.1 | orthology | 1 | 7 | - | - |
| thecc_pan_p009145 | orthology | 0.916 | 4 | 217 | 1.46e-70 |
| thecc_pan_p020513 | orthology | 1 | 4 | - | - |