Gene brana_pan_p050558
| Sequence ID | brana_pan_p050558 add to my list | ||
|---|---|---|---|
| Species | Brassica napus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 150aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 150 amino acids
>brana_pan_p050558_BRANA MANTNQPVRACVIKVDLKCCSGCLNRAKTKLQSLPGVTAAEYNVKKGLMTVTGDVDPMTL VHKLTKPKRKTELVSVNYMPDEDLTSDHEDEDEDEDGDEDEDDTSSSDDTSSNPDPRPME RAPQVNTRPTIKKKERMPMLGDLHLRFMDQ
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p050558
Represented sequence(s):
BRANA_v5.0
BRANA_Tapidor_v6.3
BRANA_Darmor_v8.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G30473.1 | orthology | 0.725 | 2 | - | - |
| Cg7g023400.1 | orthology | 1 | 5 | - | - |
| Cm012520.1 | orthology | 1 | 5 | - | - |
| Cs7g01670.1 | orthology | 1 | 4 | - | - |
| MELO3C015862.2.1 | orthology | 1 | 7 | - | - |
| braol_pan_p028920 | orthology | 0.0533 | 1 | - | - |
| cucsa_pan_p009937 | orthology | 1 | 7 | - | - |
| maldo_pan_p011650 | orthology | 1 | 6 | - | - |
| thecc_pan_p012699 | orthology | 1 | 4 | 60.5 | 1.13e-11 |