Gene brana_pan_p050967
Sequence ID | brana_pan_p050967 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 152aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 152 amino acids
>brana_pan_p050967_BRANA MGALDFLSDYFSNNFDVSIRKRKKHKVMQTVNIKVKIDCDGCERKIKNAVSSIKGAKSVE VNRKMHKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPAGFV RKSEQAQAQPGGTDDKLMSLFSDENPNACIVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p050967
Represented sequence(s):
BRANA_v5.0
BRANA_Tapidor_v6.3
BRANA_Darmor_v8.1
1. | 2. | 3. | 4. | 5. | |
---|---|---|---|---|---|
1. BnaA07g12030.1D2 | 0.00 | 1.32 | -0.00 | -0.00 | 1.32 |
2. BnaC07g15650.1D2 | 1.32 | 0.00 | 1.32 | 1.32 | -0.00 |
3. BnaC05g15470.1T | -0.00 | 1.32 | 0.00 | -0.00 | 1.32 |
4. GSBRNA2T00033152001 | -0.00 | 1.32 | -0.00 | 0.00 | 1.32 |
5. GSBRNA2T00061817001 | 1.32 | -0.00 | 1.32 | 1.32 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
braol_pan_p026013 | orthology | 0.0135 | 1 | 303 | 1.64e-107 |
brarr_pan_p015165 | orthology | 0.0206 | 2 | 296 | 5.93e-105 |