Gene brana_pan_p052678
| Sequence ID | brana_pan_p052678 add to my list |
|---|---|
| Species | Brassica napus |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 115aa |
Length: 115 amino acids
>brana_pan_p052678_BRANA MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
| 2 | GP015273 | Unannotated cluster |
| 3 | GP040583 | Unannotated cluster |
| 4 | GP463648 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Membrane transport protein
IPR004776
|
Membrane transport protein | Family |
Figure 1: IPR domains for brana_pan_p052678
Represented sequence(s):