Gene brana_pan_p057676
Sequence ID | brana_pan_p057676 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/3) | ||
Length | 175aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 175 amino acids
>brana_pan_p057676_BRANA MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSDQGKVTVSGSVDPSVL IKKLAKSGKHAEIWGAPKGNNNNQNQLANQMKGMQIDNGKGVGGKNNNNNNKGPKNGGGG GGGGGGGGGGXXXARPYANAATTTATVFSSGYEPATCHGKRAVPTNDVRKAATGS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p057676
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G06130.1 | orthology | 0.397 | 2 | - | - |
MELO3C021404.2.1 | orthology | 0.822 | 4 | - | - |
brana_pan_p070531 | ultra-paralogy | 0.152 | 0 | - | - |
brarr_pan_p028538 | orthology | 0.295 | 1 | - | - |
cucsa_pan_p012169 | orthology | 0.79 | 4 | - | - |