Gene brana_pan_p064539
Sequence ID | brana_pan_p064539 add to my list |
---|---|
Species | Brassica napus |
Alias | No gene alias |
Pangenome status | Specific (1/3) |
Length | 177aa |
Length: 177 amino acids
>brana_pan_p064539_BRANA MKGVESAESDLKGSQVTVKGVFEPQKLVDYVYKRTGKHAAIMKVDPPPPPPPEVAAAAAE GEKKEEAKGEEKDGGESKGEEGKEEKAKTDEEKKEGDGGKGEGEAAEKGGGGETGGGGEE EEAKVVEVRKIENPYYYYLYQPPRVAVPPMEMPSYAYPHAYPPQLFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Figure 1: IPR domains for brana_pan_p064539
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G63530.1 | orthology | 0.0953 | 1 | - | - |