Gene braol_pan_p011410
Sequence ID | braol_pan_p011410 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 109aa | ||
Gene Ontology |
![]()
|
Length: 109 amino acids
>braol_pan_p011410_BRAOL MSEKRLCCAVMRINMDCNACCRKVRRILINMKEVETHVIEKKERKIIVCGQFRPSDIAVK LQKKMKRRVEILEIEHLSGDHGGGEEEHYHEPQYEYPVQPDQVTTPLLC
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p011410
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg7g014560.1 | orthology | 0.957 | 5 | 108 | 6.56e-31 |
Cm038010.1 | orthology | 0.957 | 6 | 108 | 1.16e-30 |
Cs7g13150.1 | orthology | 0.957 | 6 | 108 | 7.31e-31 |
FvH4_4g27630.1 | orthology | 1 | 4 | 103 | 1.97e-30 |
Manes.06G070100.1 | orthology | 0.819 | 2 | - | - |
Manes.14G100500.1 | orthology | 0.741 | 2 | 114 | 1.29e-34 |
brana_pan_p052252 | orthology | 0.0016 | 1 | 204 | 4.21e-70 |
braol_pan_p053779 | ultra-paralogy | 0.0011 | 0 | - | - |
maldo_pan_p037558 | orthology | 1 | 4 | - | - |
maldo_pan_p044634 | orthology | 1 | 4 | - | - |
maldo_pan_p046030 | orthology | 0.975 | 4 | - | - |
maldo_pan_p049521 | orthology | 1 | 4 | - | - |
maldo_pan_p049537 | orthology | 0.984 | 4 | 114 | 2e-34 |
maldo_pan_p055366 | orthology | 1 | 4 | - | - |