Gene braol_pan_p021666
| Sequence ID | braol_pan_p021666 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 299aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 299 amino acids
>braol_pan_p021666_BRAOL MRVKIYLHIIHIVTFSSTFHSFLWLLSHLRKKNKMKGRMFCASQASTAICSSMDHIPKPT TTTVVVDDEKLSDRAIDRHNPIIKDGRRSSVDDYIRIPASPADGEISNKTIEIYKGRRSV TARKSTGGGGSGGGAAALLKLITNDLSLARKSFSCVARPSSDFVKTPAGSTRYLLGSDPG SLTGSAGQDTVAHKSPAVEEIKQSMEEKTSGGGSDQVVVLKVSLHCRGCEAKVRKHLSRM QGVTSFNIDFAAKKVTVTGDITPLGILDSISKVKNAQFWTAPTLPTPTLPMPNLETPNP
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p021666
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G37390.1 | orthology | 0.247 | 2 | - | - |
| MELO3C003095.2.1 | orthology | 1 | 4 | 147 | 1.07e-42 |
| brana_pan_p036701 | orthology | 0.0255 | 2 | 444 | 4.52e-159 |
| brarr_pan_p002630 | orthology | 0.0281 | 2 | 456 | 6.45e-164 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_09762.1 | orthology | 1 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1 | orthology | 1 | 6 | 180 | 2.28e-55 |
| cicar_pan_p008704 | orthology | 1 | 5 | 171 | 1.84e-52 |
| cicar_pan_p017889 | orthology | 1 | 5 | - | - |
| cucsa_pan_p020833 | orthology | 1 | 4 | - | - |
| medtr_pan_p001385 | orthology | 1 | 5 | - | - |
| medtr_pan_p025678 | orthology | 1 | 5 | 164 | 4.18e-49 |
| phavu.G19833.gnm2.ann1.Phvul.001G171400.1 | orthology | 1 | 6 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.L001741.1 | orthology | 1 | 6 | - | - |
| soybn_pan_p015281 | orthology | 1 | 6 | - | - |
| soybn_pan_p025035 | orthology | 1 | 6 | - | - |
| soybn_pan_p025142 | orthology | 1 | 5 | - | - |