Gene braol_pan_p024201
| Sequence ID | braol_pan_p024201 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (2/3) | ||
| Length | 156aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 156 amino acids
>braol_pan_p024201_BRAOL MTTIEMRVHMDCVGCESRVKSALQKMRGVDEVEIDMVQQKVTVTGYADQKKVLKKVRKTG RRAELWQLPFNPDHSSLLGGGSNSTNGGYFYNPHGCNGPINHHAPVPGSSYNYYKHGYDS NDYSSYQHHPVHASIFSHQAGSKFSDENPNAACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p024201
Represented sequence(s):
Unrepresented genome(s):
BRAOL_HDEM
BRAOL_TO1000
BRAOL_A2_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G06330.1 | orthology | 0.0869 | 2 | 275 | 9.71e-97 |
| Cg2g008690.1 | orthology | 0.532 | 7 | 187 | 4.83e-62 |
| Cm103060.1 | orthology | 0.526 | 8 | 187 | 5.72e-62 |
| Cs2g15540.1 | orthology | 0.526 | 8 | 189 | 1.15e-62 |
| FvH4_6g27360.1 | orthology | 0.475 | 3 | 185 | 4.27e-61 |
| MELO3C018725.2.1 | orthology | 0.593 | 6 | 166 | 9.17e-54 |
| Manes.15G048400.1 | orthology | 0.421 | 6 | 202 | 6.12e-68 |
| brana_pan_p013116 | orthology | 0 | 1 | 321 | 1.17e-114 |
| brarr_pan_p028890 | orthology | 0 | 1 | 321 | 9.45e-115 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 | orthology | 0.552 | 9 | 177 | 2.48e-58 |
| cucsa_pan_p019751 | orthology | 0.585 | 6 | 169 | 7.45e-55 |
| medtr_pan_p000903 | orthology | 0.586 | 7 | 182 | 3.43e-60 |
| phavu.G19833.gnm2.ann1.Phvul.005G095400.1 | orthology | 0.56 | 8 | 175 | 2.22e-57 |
| soybn_pan_p032804 | orthology | 0.553 | 9 | 180 | 4.74e-59 |
| thecc_pan_p014674 | orthology | 0.407 | 7 | 159 | 7.8e-51 |
| vitvi_pan_p026446 | orthology | 0.452 | 5 | 193 | 2.79e-64 |