Gene braol_pan_p025375
Sequence ID | braol_pan_p025375 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 140aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 140 amino acids
>braol_pan_p025375_BRAOL MSMTVEIRVPNLDCEGCASKLKKTLLKLKGVEEVEVEMESQKVTARGYRLEEKKVLKAVR RAGKAAEPWPYRLGNSHFASFYKYPSYVTNHYYSDAHRTDPTGGVHTFFHTPAVYSVAVA GDEIAASMFSDDNPHACTIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p025375
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G48970.1 | orthology | 0.0292 | 3 | 271 | 1.2e-95 |
AUR62015981-RA | orthology | 0.56 | 8 | - | - |
Bv3_055490_mxet.t1 | orthology | 0.593 | 8 | 199 | 4.19e-67 |
Ca_8_1007.1 | orthology | 0.487 | 11 | 198 | 2.9e-66 |
Cc02_g02970 | orthology | 0.487 | 11 | 197 | 1.85e-66 |
Cg9g026790.1 | orthology | 0.313 | 7 | 208 | 1.05e-70 |
Cm028340.1 | orthology | 0.313 | 7 | 208 | 1.77e-70 |
Cs9g17280.1 | orthology | 0.313 | 7 | 208 | 1.14e-70 |
DCAR_009368 | orthology | 0.566 | 13 | 204 | 4.44e-69 |
FvH4_7g29520.1 | orthology | 0.353 | 8 | 206 | 9.29e-70 |
HanXRQChr06g0183831 | orthology | 0.569 | 8 | 196 | 1.17e-65 |
HanXRQChr09g0253621 | orthology | 0.596 | 8 | - | - |
MELO3C003319.2.1 | orthology | 0.543 | 8 | 166 | 1.44e-53 |
Manes.14G025900.1 | orthology | 0.386 | 8 | 204 | 4.07e-69 |
Mba01_g04690.1 | orthology | 0.815 | 13 | 172 | 1.35e-56 |
Oeu024220.1 | orthology | 0.462 | 10 | 200 | 2.63e-67 |
PGSC0003DMP400025270 | orthology | 0.48 | 13 | 208 | 9.16e-71 |
Solyc03g025790.2.1 | orthology | 0.47 | 13 | 207 | 2.61e-70 |
brana_pan_p044950 | orthology | 0.001 | 2 | 276 | 1.62e-97 |
brarr_pan_p005835 | orthology | 0 | 1 | 280 | 5.92e-99 |
cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.294 | 7 | 214 | 4.26e-73 |
capan_pan_p012989 | orthology | 0.493 | 12 | 204 | 3.25e-69 |
cucsa_pan_p007884 | orthology | 0.51 | 8 | 172 | 4.04e-56 |
evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.779 | 11 | 166 | 2.3e-54 |
ipotf_pan_p019855 | orthology | 0.492 | 12 | 192 | 2.38e-64 |
ipotf_pan_p021461 | orthology | 0.664 | 12 | - | - |
itb03g13280.t1 | orthology | 0.492 | 12 | 192 | 2.57e-64 |
itb12g25750.t1 | orthology | 0.651 | 12 | - | - |
maldo_pan_p005834 | orthology | 0.359 | 8 | 206 | 7.49e-70 |
maldo_pan_p046866 | orthology | 0.784 | 8 | - | - |
medtr_pan_p031372 | orthology | 0.277 | 5 | 229 | 9.07e-79 |
musac_pan_p029616 | orthology | 0.802 | 13 | 173 | 1.05e-56 |
phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.292 | 7 | 220 | 2.27e-75 |
soybn_pan_p030070 | orthology | 0.268 | 6 | 185 | 1.28e-61 |
thecc_pan_p002573 | orthology | 0.333 | 8 | 210 | 1.93e-71 |
vitvi_pan_p028565 | orthology | 0.405 | 7 | 195 | 1.87e-65 |