Gene braol_pan_p025817
Sequence ID | braol_pan_p025817 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 158aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 158 amino acids
>braol_pan_p025817_BRAOL MGVGGTLEYISELIGSGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK SVEINKKQQKVTVSGYAEASKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG YVRKMDPYVTTGTMAVDNDDPSYTSMFSDDNPNACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p025817
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT4G39700.1 | orthology | 0.0649 | 2 | 295 | 2.32e-104 |
AUR62002038-RA | orthology | 0.387 | 5 | - | - |
AUR62003759-RA | orthology | 0.368 | 5 | 218 | 7.78e-74 |
Bv6_135550_hnzj.t1 | orthology | 0.38 | 5 | 220 | 7.14e-75 |
PGSC0003DMP400038108 | orthology | 0.318 | 4 | 231 | 4.21e-79 |
Solyc04g054500.2.1 | orthology | 0.288 | 4 | 233 | 7.25e-80 |
brana_pan_p027029 | orthology | 0.0068 | 2 | 309 | 1.03e-109 |
brarr_pan_p028146 | orthology | 0.0068 | 2 | 309 | 8.36e-110 |