Gene braol_pan_p030499
Sequence ID | braol_pan_p030499 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 150aa | ||
Gene Ontology |
![]()
|
Length: 150 amino acids
>braol_pan_p030499_BRAOL MGALDSLSEYISDYFHVSRKRRKRKVKQTVNIKVKMDCDGCERRVKNAVSSMKGVETVEL NRKIHKVTVSGYVEPKKVLKRVERTGKKAEMWPYVPYNVVAYPYAVGVYDKKAPAGYVRK SEQSQPLPGAPDDVIMSLFSDENPNACTVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p030499
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT1G71050.1 | orthology | 0.127 | 2 | 265 | 5.28e-93 |
brana_pan_p002075 | orthology | 0 | 1 | 299 | 3.68e-106 |
brarr_pan_p031034 | orthology | 0 | 1 | 299 | 2.97e-106 |