Gene braol_pan_p031467
Sequence ID | braol_pan_p031467 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 153aa | ||
Gene Ontology |
![]()
|
Length: 153 amino acids
>braol_pan_p031467_BRAOL MGVLDHVSEMFDCSHGHKIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVSLEP KAHKVTVVGYVEPNKVVSRMAHRTGKKVELWPYVPYDVVAHPYASGVYDKKAPSGYVRRA DDPGVSQLARASSTEVRYTTAFSDENPTACVVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p031467
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT4G38580.1 | orthology | 0.0531 | 2 | 303 | 7.02e-108 |
brana_pan_p029669 | orthology | 0.0076 | 2 | 244 | 6.82e-85 |
brarr_pan_p004661 | orthology | 0.0076 | 2 | 311 | 4.9e-111 |