Gene braol_pan_p040048
| Sequence ID | braol_pan_p040048 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 275aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 275 amino acids
>braol_pan_p040048_BRAOL MGKNNNNNKENKGDGGGEKKTASVTVVLKIDMHCEGCASKIVKCVRTFQGVETVKSESES GKLTVTGDVDPAKLREKLEEKTKKKVDLVSPQPKKEKEKEKDSNKDKTKNDEDKNKEKKP KEAPVTTAVLKVDFHCQGCIGKIQKTVTRTKGVNGLTMDKEKQLLTVKGTMDVKKLADTL SEKLKRKVEIVPPAKKDKENGKGKENESGDKKKGGDGGGKDNNGGNKGGEGVNAMEYVAP SYGAAYYPGGPYGYPIQAHAPQMFSDENVNACVVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP474217 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p040048
Represented sequence(s):
BRAOL_A2_v1.0
BRAOL_HDEM
BRAOL_TO1000
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Bol035998 | 0.00 | 0.73 | 0.73 | 0.36 |
| 2. BolC2p07220H | 0.73 | 0.00 | -0.00 | -0.00 |
| 3. NC_027749.1_cds_XP_013616242.1_6683 | 0.73 | -0.00 | 0.00 | -0.00 |
| 4. NC_027749.1_cds_XP_013616243.1_6684 | 0.36 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G60800.2 | orthology | 0.257 | 2 | 295 | 1.47e-100 |
| brana_pan_p055950 | orthology | 0.001 | 1 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1 | orthology | 0.968 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1 | orthology | 1 | 3 | - | - |
| cicar_pan_p020480 | orthology | 0.826 | 4 | - | - |
| cicar_pan_p021432 | orthology | 0.861 | 4 | - | - |
| medtr_pan_p011734 | orthology | 0.953 | 4 | - | - |
| medtr_pan_p013059 | orthology | 0.913 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.005G131500.1 | orthology | 1 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.011G084200.1 | orthology | 0.863 | 4 | - | - |
| soybn_pan_p003591 | orthology | 0.932 | 4 | - | - |
| soybn_pan_p023786 | orthology | 0.871 | 5 | - | - |
| soybn_pan_p027875 | orthology | 1 | 5 | - | - |
| soybn_pan_p029836 | orthology | 0.865 | 5 | - | - |