Gene brarr_pan_p004661
| Sequence ID | brarr_pan_p004661 add to my list | ||
|---|---|---|---|
| Species | Brassica rapa subsp. rapa | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 153aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 153 amino acids
>brarr_pan_p004661_BRARR MGVLDHVSEMFDCSHGHKIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVSLEP KAHKVTVVGYVEPNKVVSRMAHRTGKKVELWPYVPYDVVAHPYASGVYDKKAPSGYVRRA DDPGVSQLARASSTEVRYTTAFSDENPAACVVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p004661
Represented sequence(s):
BRARR_Z1
BRARR_v3.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G38580.1 | orthology | 0.0476 | 3 | - | - |
| brana_pan_p029669 | orthology | 0.0011 | 1 | 245 | 3.38e-85 |
| braol_pan_p031467 | orthology | 0.0076 | 2 | 311 | 1.11e-110 |