Gene brarr_pan_p004667
Sequence ID | brarr_pan_p004667 add to my list |
---|---|
Species | Brassica rapa subsp. rapa |
Alias | No gene alias |
Pangenome status | Core (2/2) |
Length | 61aa |
Length: 61 amino acids
>brarr_pan_p004667_BRARR MAASTGGGKAKYIIGALIGSFGISYLFDKGVPQERSLTRNGGRRQMRSSKLGLEPLALPS S
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
BRARR_v3.0
BRARR_Z1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT1G01170.1 | orthology | 0.664 | 2 | - | - |
FvH4_3g28670.1 | orthology | 1 | 5 | - | - |
FvH4_5g27260.1 | orthology | 1 | 5 | - | - |
brana_pan_p024714 | orthology | 0.635 | 2 | - | - |
braol_pan_p040163 | orthology | 0.635 | 2 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_09476.1 | orthology | 1 | 7 | - | - |
cicar_pan_p021438 | orthology | 1 | 5 | - | - |
cicar_pan_p021882 | orthology | 1 | 5 | - | - |
maldo_pan_p050830 | orthology | 1 | 5 | - | - |
medtr_pan_p001744 | orthology | 1 | 6 | - | - |
medtr_pan_p009141 | orthology | 1 | 6 | - | - |
phavu.G19833.gnm2.ann1.Phvul.001G134700.2 | orthology | 1 | 8 | - | - |
soybn_pan_p000766 | orthology | 1 | 8 | - | - |
soybn_pan_p008913 | orthology | 1 | 8 | - | - |
soybn_pan_p014436 | orthology | 1 | 8 | - | - |
soybn_pan_p035092 | orthology | 1 | 8 | - | - |