Gene brarr_pan_p006813
Sequence ID | brarr_pan_p006813 add to my list | ||
---|---|---|---|
Species | Brassica rapa subsp. rapa | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 158aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 158 amino acids
>brarr_pan_p006813_BRARR MLDWIHGNYRLPLALSVVELLVDMDCQGCEKKVRRAISKLDGVDTVEIDVDQQKVTVTGY VDREDVLSMVKRTGRAAEFWPFPYNGYYGDYYTYPSQYLEQPIQKINHAENTISYNGKYD SYDESTITGYNYPRPTQKVDENALHLFSDDNVHACAVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Heavy-metal-associated, conserved site
IPR017969
|
Heavy-metal-associated, conserved site | Conserved_site |
Figure 1: IPR domains for brarr_pan_p006813
Represented sequence(s):
BRARR_v3.0
BRARR_Z1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56891.1 | orthology | 0.211 | 3 | 253 | 1.25e-87 |
Ca_28_123.1 | orthology | 1 | 8 | - | - |
Ca_31_155.3 | orthology | 1 | 8 | - | - |
Ca_64_676.1 | orthology | 1 | 8 | - | - |
Ca_78_1273.1 | orthology | 1 | 8 | - | - |
Cc06_g21060 | orthology | 0.96 | 8 | - | - |
Cg6g011520.1 | orthology | 0.877 | 10 | - | - |
Cs6g10930.1 | orthology | 0.871 | 10 | - | - |
DCAR_016949 | orthology | 1 | 8 | - | - |
FvH4_2g26780.1 | orthology | 0.878 | 8 | 130 | 2.42e-39 |
MELO3C019416.2.1 | orthology | 0.956 | 10 | - | - |
Manes.08G099200.1 | orthology | 0.825 | 6 | 150 | 2.42e-47 |
Oeu053981.1 | orthology | 1 | 9 | - | - |
brana_pan_p033418 | orthology | 0.0119 | 1 | 325 | 2.86e-116 |
braol_pan_p038031 | orthology | 0.049 | 2 | 315 | 3.41e-112 |
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 1 | 12 | - | - |
cucsa_pan_p011351 | orthology | 0.989 | 10 | - | - |
ipotf_pan_p003030 | orthology | 1 | 10 | - | - |
itb11g01700.t1 | orthology | 1 | 10 | - | - |
maldo_pan_p024328 | orthology | 0.962 | 8 | - | - |
maldo_pan_p038662 | orthology | 0.868 | 8 | 129 | 1.09e-38 |
medtr_pan_p030129 | orthology | 0.964 | 10 | - | - |
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 1 | 11 | - | - |
soybn_pan_p020075 | orthology | 1 | 12 | - | - |
thecc_pan_p019791 | orthology | 0.83 | 9 | - | - |
vitvi_pan_p003255 | orthology | 0.817 | 6 | 139 | 8.44e-43 |